PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.11G003400.1.p
Common NameGLYMA_11G003400, LOC100782240
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HD-ZIP
Protein Properties Length: 733aa    MW: 80461 Da    PI: 6.182
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.11G003400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox581.6e-1863118156
                          TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          ++  +++t+ q+ee+e++F++ ++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k
  Glyma.11G003400.1.p  63 KKGYRRHTQRQIEEMEAFFKQFPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMK 118
                          5778899**********************************************999 PP

2START210.94.7e-662504701206
                          HHHHHHHHHHHHHHHHC-TT-EEEE...EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S.... CS
                START   1 elaeeaaqelvkkalaeepgWvkss...esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla.... 77 
                          ela +a++el ++a+a++p+Wv s    e++n++e+l++f+  +        ++ea+r+s+vv+m++ +l  +l+d++ qW++ +     
  Glyma.11G003400.1.p 250 ELAVAAMEELTRLAQAGDPLWVPSNhhsEILNEEEYLRTFPNRGLgpkplgLRSEASRESVVVIMNHINLIDILMDVN-QWSTVFCgivs 338
                          57899***********************************77666*********************************.******99999 PP

                          EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTC CS
                START  78 kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksng 160
                          +a tlev+s+g      galq+m++e+q++splvp R+ +fvRy++q+++g w++vdvS+d+ ++++    + R++++pSg+li++++ng
  Glyma.11G003400.1.p 339 RALTLEVLSTGvagnynGALQVMSSEFQVPSPLVPtRENYFVRYCKQQPDGIWAVVDVSLDNLRPNT----ISRSRRRPSGCLIQELPNG 424
                          ******************************************************************9....69***************** PP

                          EEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                START 161 hskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                          +skvtw+ehv++++r +h+++r+lv+sgla+gak+wvatl+rqce+
  Glyma.11G003400.1.p 425 YSKVTWIEHVEVDDRAVHSIYRPLVNSGLAFGAKRWVATLDRQCER 470
                          ********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.1E-2048118IPR009057Homeodomain-like
SuperFamilySSF466896.68E-1848120IPR009057Homeodomain-like
PROSITE profilePS5007116.53660120IPR001356Homeobox domain
SMARTSM003893.7E-1762124IPR001356Homeobox domain
PfamPF000465.1E-1663118IPR001356Homeobox domain
CDDcd000862.20E-1763121No hitNo description
PROSITE patternPS00027095118IPR017970Homeobox, conserved site
PROSITE profilePS5084845.407241473IPR002913START domain
SuperFamilySSF559614.53E-37242472No hitNo description
CDDcd088751.03E-123245469No hitNo description
SMARTSM002341.3E-68250470IPR002913START domain
PfamPF018528.0E-56251470IPR002913START domain
Gene3DG3DSA:3.30.530.208.5E-6352470IPR023393START-like domain
SuperFamilySSF559616.18E-24491721No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0009913Biological Processepidermal cell differentiation
GO:0048497Biological Processmaintenance of floral organ identity
GO:0048825Biological Processcotyledon development
GO:0090627Biological Processplant epidermal cell differentiation
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 733 aa     Download sequence    Send to blast
MFHANMFDSH PHLLDMSPHK TTACSESDLG KACRDDEYET KSITDAMDAP SGDDQDPNPR  60
PKKKGYRRHT QRQIEEMEAF FKQFPHPDDK QRKELSRELG LEPLQVKFWF QNKRTQMKTQ  120
HERNENAILK TENEKLRAEN NRYKEALSNA TCPNCGGSAA LGEMSFDEQH LRIENARLRE  180
EIDRISGIAA KYVGKPVTSS YSNLSSLNNN HVPVGKYGSQ SGTVGEMYGG SDLFRSLPAP  240
ADADKPMIVE LAVAAMEELT RLAQAGDPLW VPSNHHSEIL NEEEYLRTFP NRGLGPKPLG  300
LRSEASRESV VVIMNHINLI DILMDVNQWS TVFCGIVSRA LTLEVLSTGV AGNYNGALQV  360
MSSEFQVPSP LVPTRENYFV RYCKQQPDGI WAVVDVSLDN LRPNTISRSR RRPSGCLIQE  420
LPNGYSKVTW IEHVEVDDRA VHSIYRPLVN SGLAFGAKRW VATLDRQCER LASSMANNIP  480
AGDLCVITSA EGRKSMMKLA ERMVMSYCTG VGASTAHAWT TLSATGCDDV RVMTRKSTDE  540
PGRPPGIVLS AATSFWLPVP PNRVFDFLRD ENSRNEWDIL SNGGLVQELA HIANGRDPGN  600
CVSLLRVNSA NSSQSNMLIL QESCTDSTGS YVVYAPVDIV AMNVVLSGGD PDYVALLPSG  660
FAILPDGPPA LNGGPMHEVG SGGSLLTVGF QILVDSAPTA KLSLGSVATV NSLIKCTVER  720
IKVAVIRDNN NT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150431e-157AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003538765.10.0PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like
RefseqXP_006590391.10.0PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like
SwissprotQ8RWU40.0ATML1_ARATH; Homeobox-leucine zipper protein MERISTEM L1
TrEMBLK7LMB00.0K7LMB0_SOYBN; Uncharacterized protein
STRINGGLYMA11G00570.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15083499
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21750.20.0HD-ZIP family protein